NPC2 monoclonal antibody (M01), clone 4B9
  • NPC2 monoclonal antibody (M01), clone 4B9

NPC2 monoclonal antibody (M01), clone 4B9

Ref: AB-H00010577-M01
NPC2 monoclonal antibody (M01), clone 4B9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant NPC2.
Información adicional
Size 100 ug
Gene Name NPC2
Gene Alias HE1|MGC1333|NP-C2
Gene Description Niemann-Pick disease, type C2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NPC2 (AAH02532, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10577
Clone Number 4B9
Iso type IgG2b Kappa

Enviar un mensaje


NPC2 monoclonal antibody (M01), clone 4B9

NPC2 monoclonal antibody (M01), clone 4B9