Ver mas grande
NPC2 purified MaxPab rabbit polyclonal antibody (D01P)
AB-H00010577-D01P
Producto nuevo
NPC2 purified MaxPab rabbit polyclonal antibody (D01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | NPC2 |
| Gene Alias | HE1|MGC1333|NP-C2 |
| Gene Description | Niemann-Pick disease, type C2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,WB-Tr |
| Immunogen Prot. Seq | MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | NPC2 (NP_006423.1, 1 a.a. ~ 151 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10577 |
Más información
Rabbit polyclonal antibody raised against a full-length human NPC2 protein.