NPC2 purified MaxPab rabbit polyclonal antibody (D01P)
  • NPC2 purified MaxPab rabbit polyclonal antibody (D01P)

NPC2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010577-D01P
NPC2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NPC2 protein.
Información adicional
Size 100 ug
Gene Name NPC2
Gene Alias HE1|MGC1333|NP-C2
Gene Description Niemann-Pick disease, type C2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NPC2 (NP_006423.1, 1 a.a. ~ 151 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10577

Enviar un mensaje


NPC2 purified MaxPab rabbit polyclonal antibody (D01P)

NPC2 purified MaxPab rabbit polyclonal antibody (D01P)