CCT7 monoclonal antibody (M02), clone 3A6
  • CCT7 monoclonal antibody (M02), clone 3A6

CCT7 monoclonal antibody (M02), clone 3A6

Ref: AB-H00010574-M02
CCT7 monoclonal antibody (M02), clone 3A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCT7.
Información adicional
Size 100 ug
Gene Name CCT7
Gene Alias CCT-ETA|Ccth|MGC110985|Nip7-1|TCP-1-eta
Gene Description chaperonin containing TCP1, subunit 7 (eta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCT7 (AAH19296, 425 a.a. ~ 528 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10574
Clone Number 3A6
Iso type IgG2a Kappa

Enviar un mensaje


CCT7 monoclonal antibody (M02), clone 3A6

CCT7 monoclonal antibody (M02), clone 3A6