MRPL28 purified MaxPab mouse polyclonal antibody (B02P)
  • MRPL28 purified MaxPab mouse polyclonal antibody (B02P)

MRPL28 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00010573-B02P
MRPL28 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MRPL28 protein.
Información adicional
Size 50 ug
Gene Name MRPL28
Gene Alias MAAT1|MGC8499|p15
Gene Description mitochondrial ribosomal protein L28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPL28 (NP_006419.2, 1 a.a. ~ 256 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10573

Enviar un mensaje


MRPL28 purified MaxPab mouse polyclonal antibody (B02P)

MRPL28 purified MaxPab mouse polyclonal antibody (B02P)