DPYSL4 monoclonal antibody (M01), clone 1F5
  • DPYSL4 monoclonal antibody (M01), clone 1F5

DPYSL4 monoclonal antibody (M01), clone 1F5

Ref: AB-H00010570-M01
DPYSL4 monoclonal antibody (M01), clone 1F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DPYSL4.
Información adicional
Size 100 ug
Gene Name DPYSL4
Gene Alias CRMP3|DRP-4|ULIP4
Gene Description dihydropyrimidinase-like 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq VTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPYSL4 (NP_006417, 461 a.a. ~ 559 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10570
Clone Number 1F5
Iso type IgG2b Kappa

Enviar un mensaje


DPYSL4 monoclonal antibody (M01), clone 1F5

DPYSL4 monoclonal antibody (M01), clone 1F5