RABAC1 monoclonal antibody (M01), clone 2A4
  • RABAC1 monoclonal antibody (M01), clone 2A4

RABAC1 monoclonal antibody (M01), clone 2A4

Ref: AB-H00010567-M01
RABAC1 monoclonal antibody (M01), clone 2A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RABAC1.
Información adicional
Size 100 ug
Gene Name RABAC1
Gene Alias PRA1|PRAF1|YIP3
Gene Description Rab acceptor 1 (prenylated)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RABAC1 (NP_006414.1, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10567
Clone Number 2A4
Iso type IgG2a Kappa

Enviar un mensaje


RABAC1 monoclonal antibody (M01), clone 2A4

RABAC1 monoclonal antibody (M01), clone 2A4