PRDX4 monoclonal antibody (M03), clone 4C3
  • PRDX4 monoclonal antibody (M03), clone 4C3

PRDX4 monoclonal antibody (M03), clone 4C3

Ref: AB-H00010549-M03
PRDX4 monoclonal antibody (M03), clone 4C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRDX4.
Información adicional
Size 100 ug
Gene Name PRDX4
Gene Alias AOE37-2|PRX-4
Gene Description peroxiredoxin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CHFFAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRDX4 (AAH03609, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10549
Clone Number 4C3
Iso type IgG1 Kappa

Enviar un mensaje


PRDX4 monoclonal antibody (M03), clone 4C3

PRDX4 monoclonal antibody (M03), clone 4C3