Ver mas grande
PRDX4 MaxPab rabbit polyclonal antibody (D01)
AB-H00010549-D01
Producto nuevo
PRDX4 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | PRDX4 |
| Gene Alias | AOE37-2|PRX-4 |
| Gene Description | peroxiredoxin 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP |
| Immunogen Prot. Seq | MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSET |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | PRDX4 (NP_006397.1, 1 a.a. ~ 271 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 10549 |
Más información
Rabbit polyclonal antibody raised against a full-length human PRDX4 protein.