PRDX4 MaxPab rabbit polyclonal antibody (D01)
  • PRDX4 MaxPab rabbit polyclonal antibody (D01)

PRDX4 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010549-D01
PRDX4 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRDX4 protein.
Información adicional
Size 100 uL
Gene Name PRDX4
Gene Alias AOE37-2|PRX-4
Gene Description peroxiredoxin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRDX4 (NP_006397.1, 1 a.a. ~ 271 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10549

Enviar un mensaje


PRDX4 MaxPab rabbit polyclonal antibody (D01)

PRDX4 MaxPab rabbit polyclonal antibody (D01)