PRDX4 purified MaxPab mouse polyclonal antibody (B01P)
  • PRDX4 purified MaxPab mouse polyclonal antibody (B01P)

PRDX4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010549-B01P
PRDX4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRDX4 protein.
Información adicional
Size 50 ug
Gene Name PRDX4
Gene Alias AOE37-2|PRX-4
Gene Description peroxiredoxin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRDX4 (NP_006397, 1 a.a. ~ 271 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10549

Enviar un mensaje


PRDX4 purified MaxPab mouse polyclonal antibody (B01P)

PRDX4 purified MaxPab mouse polyclonal antibody (B01P)