HBXIP purified MaxPab rabbit polyclonal antibody (D02P)
  • HBXIP purified MaxPab rabbit polyclonal antibody (D02P)

HBXIP purified MaxPab rabbit polyclonal antibody (D02P)

Ref: AB-H00010542-D02P
HBXIP purified MaxPab rabbit polyclonal antibody (D02P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HBXIP protein.
Información adicional
Size 100 ug
Gene Name HBXIP
Gene Alias MGC71071|XIP
Gene Description hepatitis B virus x interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HBXIP (NP_006393.2, 1 a.a. ~ 173 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10542

Enviar un mensaje


HBXIP purified MaxPab rabbit polyclonal antibody (D02P)

HBXIP purified MaxPab rabbit polyclonal antibody (D02P)