GLRX3 purified MaxPab rabbit polyclonal antibody (D01P)
  • GLRX3 purified MaxPab rabbit polyclonal antibody (D01P)

GLRX3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010539-D01P
GLRX3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GLRX3 protein.
Información adicional
Size 100 ug
Gene Name GLRX3
Gene Alias FLJ11864|GLRX4|GRX3|GRX4|PICOT|TXNL2|TXNL3|bA500G10.4
Gene Description glutaredoxin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GLRX3 (NP_006532.2, 1 a.a. ~ 335 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10539

Enviar un mensaje


GLRX3 purified MaxPab rabbit polyclonal antibody (D01P)

GLRX3 purified MaxPab rabbit polyclonal antibody (D01P)