BATF monoclonal antibody (M03), clone 1G4
  • BATF monoclonal antibody (M03), clone 1G4

BATF monoclonal antibody (M03), clone 1G4

Ref: AB-H00010538-M03
BATF monoclonal antibody (M03), clone 1G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BATF.
Información adicional
Size 100 ug
Gene Name BATF
Gene Alias B-ATF|BATF1|SFA-2|SFA2
Gene Description basic leucine zipper transcription factor, ATF-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10538
Clone Number 1G4
Iso type IgG1 Kappa

Enviar un mensaje


BATF monoclonal antibody (M03), clone 1G4

BATF monoclonal antibody (M03), clone 1G4