BATF purified MaxPab mouse polyclonal antibody (B01P)
  • BATF purified MaxPab mouse polyclonal antibody (B01P)

BATF purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010538-B01P
BATF purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BATF protein.
Información adicional
Size 50 ug
Gene Name BATF
Gene Alias B-ATF|BATF1|SFA-2|SFA2
Gene Description basic leucine zipper transcription factor, ATF-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BATF (NP_006390.1, 1 a.a. ~ 125 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10538

Enviar un mensaje


BATF purified MaxPab mouse polyclonal antibody (B01P)

BATF purified MaxPab mouse polyclonal antibody (B01P)