UBD purified MaxPab rabbit polyclonal antibody (D01P)
  • UBD purified MaxPab rabbit polyclonal antibody (D01P)

UBD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010537-D01P
UBD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UBD protein.
Información adicional
Size 100 ug
Gene Name UBD
Gene Alias FAT10|GABBR1|UBD-3
Gene Description ubiquitin D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLASYCIGG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBD (NP_006389.1, 1 a.a. ~ 165 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10537

Enviar un mensaje


UBD purified MaxPab rabbit polyclonal antibody (D01P)

UBD purified MaxPab rabbit polyclonal antibody (D01P)