ATG7 MaxPab rabbit polyclonal antibody (D01)
  • ATG7 MaxPab rabbit polyclonal antibody (D01)

ATG7 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010533-D01
ATG7 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ATG7 protein.
Información adicional
Size 100 uL
Gene Name ATG7
Gene Alias APG7-LIKE|APG7L|DKFZp434N0735|GSA7
Gene Description ATG7 autophagy related 7 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ATG7 (NP_006386.1, 1 a.a. ~ 703 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10533

Enviar un mensaje


ATG7 MaxPab rabbit polyclonal antibody (D01)

ATG7 MaxPab rabbit polyclonal antibody (D01)