CIB2 polyclonal antibody (A01)
  • CIB2 polyclonal antibody (A01)

CIB2 polyclonal antibody (A01)

Ref: AB-H00010518-A01
CIB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CIB2.
Información adicional
Size 50 uL
Gene Name CIB2
Gene Alias KIP2
Gene Description calcium and integrin binding family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIB2 (NP_006374, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10518

Enviar un mensaje


CIB2 polyclonal antibody (A01)

CIB2 polyclonal antibody (A01)