MYBBP1A purified MaxPab mouse polyclonal antibody (B01P)
  • MYBBP1A purified MaxPab mouse polyclonal antibody (B01P)

MYBBP1A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010514-B01P
MYBBP1A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MYBBP1A protein.
Información adicional
Size 50 ug
Gene Name MYBBP1A
Gene Alias FLJ37886|P160|PAP2
Gene Description MYB binding protein (P160) 1a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEYLRGRPKGSEMKYALKRLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVGSVNLFSDENVPRLVNVLKMAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYBBP1A (AAH50546.1, 1 a.a. ~ 1328 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10514

Enviar un mensaje


MYBBP1A purified MaxPab mouse polyclonal antibody (B01P)

MYBBP1A purified MaxPab mouse polyclonal antibody (B01P)