APPBP2 purified MaxPab mouse polyclonal antibody (B01P)
  • APPBP2 purified MaxPab mouse polyclonal antibody (B01P)

APPBP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010513-B01P
APPBP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human APPBP2 protein.
Información adicional
Size 50 ug
Gene Name APPBP2
Gene Alias HS.84084|KIAA0228|PAT1
Gene Description amyloid beta precursor protein (cytoplasmic tail) binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAVELEWIPETLYNTAISAVVDNYIRSRRDIRSLPENIQFDVYYKLYQQGRLCQLGSEFCELEVFAKVLRALDKRHLLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESDAAVKEKAIQVGFVLGGFLSDAGWYSDAEKVFLSCLQLCTLHDEMLHWFRAVECCVRLLHVRNGNCKYHLGEETFKLAQTYMDKLSKHGQQANKAALYGELCALLFAKSHYDEAYKWCIEAMKEITAGLPVKVVVDVLRQASKA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen APPBP2 (NP_006371.2, 1 a.a. ~ 585 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10513

Enviar un mensaje


APPBP2 purified MaxPab mouse polyclonal antibody (B01P)

APPBP2 purified MaxPab mouse polyclonal antibody (B01P)