SEMA4B polyclonal antibody (A01)
  • SEMA4B polyclonal antibody (A01)

SEMA4B polyclonal antibody (A01)

Ref: AB-H00010509-A01
SEMA4B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEMA4B.
Información adicional
Size 50 uL
Gene Name SEMA4B
Gene Alias KIAA1745|MGC131831|SEMAC|SemC
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GEKPCEQVQFQPNTVNTLACPLLSNLATRLWLRNGAPVNASASCHVLPTGDLLLVGTQQLGEFQCWSLEEGFQQLVASYCPEVVEDGVADQTDEGGSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA4B (NP_064595, 592 a.a. ~ 689 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10509

Enviar un mensaje


SEMA4B polyclonal antibody (A01)

SEMA4B polyclonal antibody (A01)