SEMA6C purified MaxPab mouse polyclonal antibody (B01P)
  • SEMA6C purified MaxPab mouse polyclonal antibody (B01P)

SEMA6C purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010500-B01P
SEMA6C purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SEMA6C protein.
Información adicional
Size 50 ug
Gene Name SEMA6C
Gene Alias SEMAY|m-SemaY|m-SemaY2
Gene Description sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPRAPHFMPLLLLLLLLSLPHTQAAFPQDPLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDECYNYIRVLVPWDSQTLLACGTNSFSPVCRSYGITSLQQEGEELSGQARCPFDATQSNVAIFAEGSLYSATAADFQASDAVVYRSLGPQPPLRSAKYDSKWLREPHFVQALEHGDHVYFFFREVSVEDARLGRVQF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEMA6C (NP_112175, 1 a.a. ~ 930 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10500

Enviar un mensaje


SEMA6C purified MaxPab mouse polyclonal antibody (B01P)

SEMA6C purified MaxPab mouse polyclonal antibody (B01P)