SEMA6C polyclonal antibody (A01)
  • SEMA6C polyclonal antibody (A01)

SEMA6C polyclonal antibody (A01)

Ref: AB-H00010500-A01
SEMA6C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEMA6C.
Información adicional
Size 50 uL
Gene Name SEMA6C
Gene Alias SEMAY|m-SemaY|m-SemaY2
Gene Description sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QDPLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDECYNYIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA6C (NP_112175, 28 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10500

Enviar un mensaje


SEMA6C polyclonal antibody (A01)

SEMA6C polyclonal antibody (A01)