ENOX2 polyclonal antibody (A01)
  • ENOX2 polyclonal antibody (A01)

ENOX2 polyclonal antibody (A01)

Ref: AB-H00010495-A01
ENOX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ENOX2.
Información adicional
Size 50 uL
Gene Name ENOX2
Gene Alias APK1|COVA1|tNOX
Gene Description ecto-NOX disulfide-thiol exchanger 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AHEKDMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEIRNIHNDELMG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENOX2 (NP_872114, 309 a.a. ~ 379 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10495

Enviar un mensaje


ENOX2 polyclonal antibody (A01)

ENOX2 polyclonal antibody (A01)