CREB3 monoclonal antibody (M01), clone 3H5
  • CREB3 monoclonal antibody (M01), clone 3H5

CREB3 monoclonal antibody (M01), clone 3H5

Ref: AB-H00010488-M01
CREB3 monoclonal antibody (M01), clone 3H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CREB3.
Información adicional
Size 100 ug
Gene Name CREB3
Gene Alias LUMAN|LZIP|MGC15333|MGC19782
Gene Description cAMP responsive element binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq DPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CREB3 (NP_006359, 273 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10488
Clone Number 3H5
Iso type IgG2a Kappa

Enviar un mensaje


CREB3 monoclonal antibody (M01), clone 3H5

CREB3 monoclonal antibody (M01), clone 3H5