CAP1 MaxPab rabbit polyclonal antibody (D01)
  • CAP1 MaxPab rabbit polyclonal antibody (D01)

CAP1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010487-D01
CAP1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CAP1 protein.
Información adicional
Size 100 uL
Gene Name CAP1
Gene Alias CAP|CAP1-PEN
Gene Description CAP, adenylate cyclase-associated protein 1 (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASRS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAP1 (NP_006358.1, 1 a.a. ~ 475 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10487

Enviar un mensaje


CAP1 MaxPab rabbit polyclonal antibody (D01)

CAP1 MaxPab rabbit polyclonal antibody (D01)