CAP1 purified MaxPab mouse polyclonal antibody (B01P)
  • CAP1 purified MaxPab mouse polyclonal antibody (B01P)

CAP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010487-B01P
CAP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CAP1 protein.
Información adicional
Size 50 ug
Gene Name CAP1
Gene Alias CAP|CAP1-PEN
Gene Description CAP, adenylate cyclase-associated protein 1 (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASRS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAP1 (NP_006358.1, 1 a.a. ~ 475 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10487

Enviar un mensaje


CAP1 purified MaxPab mouse polyclonal antibody (B01P)

CAP1 purified MaxPab mouse polyclonal antibody (B01P)