TRIM38 MaxPab mouse polyclonal antibody (B01P)
  • TRIM38 MaxPab mouse polyclonal antibody (B01P)

TRIM38 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010475-B01P
TRIM38 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM38 protein.
Información adicional
Size 50 ug
Gene Name TRIM38
Gene Alias MGC8946|RNF15|RORET
Gene Description tripartite motif-containing 38
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCPQCRAPFHMDSLRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQHKGHTTALVEDVCQGYKEKLQKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIRSDFKNLQCFLHEEEKSYLWRLEKEEQQTLSRLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM38 (NP_006346, 1 a.a. ~ 465 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10475

Enviar un mensaje


TRIM38 MaxPab mouse polyclonal antibody (B01P)

TRIM38 MaxPab mouse polyclonal antibody (B01P)