TADA3L purified MaxPab rabbit polyclonal antibody (D01P)
  • TADA3L purified MaxPab rabbit polyclonal antibody (D01P)

TADA3L purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010474-D01P
TADA3L purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TADA3L protein.
Información adicional
Size 100 ug
Gene Name TADA3L
Gene Alias ADA3|FLJ20221|FLJ21329|hADA3
Gene Description transcriptional adaptor 3 (NGG1 homolog, yeast)-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TADA3L (NP_597814.1, 1 a.a. ~ 369 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10474

Enviar un mensaje


TADA3L purified MaxPab rabbit polyclonal antibody (D01P)

TADA3L purified MaxPab rabbit polyclonal antibody (D01P)