ZNF238 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZNF238 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF238 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010472-D01P
ZNF238 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF238 protein.
Información adicional
Size 100 ug
Gene Name ZNF238
Gene Alias C2H2-171|RP58|TAZ-1|ZBTB18
Gene Description zinc finger protein 238
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIVKVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF238 (NP_006343.2, 1 a.a. ~ 522 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10472

Enviar un mensaje


ZNF238 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF238 purified MaxPab rabbit polyclonal antibody (D01P)