FST purified MaxPab mouse polyclonal antibody (B01P)
  • FST purified MaxPab mouse polyclonal antibody (B01P)

FST purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010468-B01P
FST purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FST protein.
Información adicional
Size 50 ug
Gene Name FST
Gene Alias FS
Gene Description follistatin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FST (NP_037541.1, 1 a.a. ~ 344 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10468

Enviar un mensaje


FST purified MaxPab mouse polyclonal antibody (B01P)

FST purified MaxPab mouse polyclonal antibody (B01P)