ZNHIT1 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNHIT1 purified MaxPab mouse polyclonal antibody (B01P)

ZNHIT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010467-B01P
ZNHIT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNHIT1 protein.
Información adicional
Size 50 ug
Gene Name ZNHIT1
Gene Alias CG1I|ZNFN4A1
Gene Description zinc finger, HIT type 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNHIT1 (NP_006340.1, 1 a.a. ~ 154 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10467

Enviar un mensaje


ZNHIT1 purified MaxPab mouse polyclonal antibody (B01P)

ZNHIT1 purified MaxPab mouse polyclonal antibody (B01P)