PPIH polyclonal antibody (A01)
  • PPIH polyclonal antibody (A01)

PPIH polyclonal antibody (A01)

Ref: AB-H00010465-A01
PPIH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PPIH.
Información adicional
Size 50 uL
Gene Name PPIH
Gene Alias CYP-20|CYPH|MGC5016|SnuCyp-20|USA-CYP
Gene Description peptidylprolyl isomerase H (cyclophilin H)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPIH (AAH03412, 1 a.a. ~ 177 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10465

Enviar un mensaje


PPIH polyclonal antibody (A01)

PPIH polyclonal antibody (A01)