MAD2L2 MaxPab rabbit polyclonal antibody (D01)
  • MAD2L2 MaxPab rabbit polyclonal antibody (D01)

MAD2L2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010459-D01
MAD2L2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MAD2L2 protein.
Información adicional
Size 100 uL
Gene Name MAD2L2
Gene Alias MAD2B|REV7
Gene Description MAD2 mitotic arrest deficient-like 2 (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAD2L2 (AAH15244.1, 1 a.a. ~ 211 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10459

Enviar un mensaje


MAD2L2 MaxPab rabbit polyclonal antibody (D01)

MAD2L2 MaxPab rabbit polyclonal antibody (D01)