GPNMB polyclonal antibody (A01)
  • GPNMB polyclonal antibody (A01)

GPNMB polyclonal antibody (A01)

Ref: AB-H00010457-A01
GPNMB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GPNMB.
Información adicional
Size 50 uL
Gene Name GPNMB
Gene Alias HGFIN|NMB
Gene Description glycoprotein (transmembrane) nmb
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPNMB (NP_001005340, 104 a.a. ~ 203 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10457

Enviar un mensaje


GPNMB polyclonal antibody (A01)

GPNMB polyclonal antibody (A01)