PPIE monoclonal antibody (M02), clone 2F5
  • PPIE monoclonal antibody (M02), clone 2F5

PPIE monoclonal antibody (M02), clone 2F5

Ref: AB-H00010450-M02
PPIE monoclonal antibody (M02), clone 2F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPIE.
Información adicional
Size 100 ug
Gene Name PPIE
Gene Alias CYP-33|MGC111222|MGC3736
Gene Description peptidylprolyl isomerase E (cyclophilin E)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPIE (NP_006103, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10450
Clone Number 2F5
Iso type IgG2a Kappa

Enviar un mensaje


PPIE monoclonal antibody (M02), clone 2F5

PPIE monoclonal antibody (M02), clone 2F5