OLFM1 monoclonal antibody (M02), clone 2E9-1A2
  • OLFM1 monoclonal antibody (M02), clone 2E9-1A2

OLFM1 monoclonal antibody (M02), clone 2E9-1A2

Ref: AB-H00010439-M02
OLFM1 monoclonal antibody (M02), clone 2E9-1A2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant OLFM1.
Información adicional
Size 100 ug
Gene Name OLFM1
Gene Alias AMY|NOE1|NOELIN1|OlfA
Gene Description olfactomedin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OLFM1 (AAH00189, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10439
Clone Number 2E9-1A2
Iso type IgG1 Kappa

Enviar un mensaje


OLFM1 monoclonal antibody (M02), clone 2E9-1A2

OLFM1 monoclonal antibody (M02), clone 2E9-1A2