C1D monoclonal antibody (M03), clone 6H2
  • C1D monoclonal antibody (M03), clone 6H2

C1D monoclonal antibody (M03), clone 6H2

Ref: AB-H00010438-M03
C1D monoclonal antibody (M03), clone 6H2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant C1D.
Información adicional
Size 100 ug
Gene Name C1D
Gene Alias MGC12261|MGC14659|SUNCOR
Gene Description nuclear DNA-binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C1D (AAH05235, 1 a.a. ~ 141 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10438
Clone Number 6H2
Iso type IgG2a Kappa

Enviar un mensaje


C1D monoclonal antibody (M03), clone 6H2

C1D monoclonal antibody (M03), clone 6H2