IFI30 purified MaxPab mouse polyclonal antibody (B01P)
  • IFI30 purified MaxPab mouse polyclonal antibody (B01P)

IFI30 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010437-B01P
IFI30 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IFI30 protein.
Información adicional
Size 50 ug
Gene Name IFI30
Gene Alias GILT|IFI-30|IP30|MGC32056
Gene Description interferon, gamma-inducible protein 30
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFI30 (NP_006323, 1 a.a. ~ 250 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10437

Enviar un mensaje


IFI30 purified MaxPab mouse polyclonal antibody (B01P)

IFI30 purified MaxPab mouse polyclonal antibody (B01P)