CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)

CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010435-D01P
CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDC42EP2 protein.
Información adicional
Size 100 ug
Gene Name CDC42EP2
Gene Alias BORG1|CEP2
Gene Description CDC42 effector protein (Rho GTPase binding) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC42EP2 (NP_006770.1, 1 a.a. ~ 210 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10435

Enviar un mensaje


CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)

CDC42EP2 purified MaxPab rabbit polyclonal antibody (D01P)