RBM14 monoclonal antibody (M01), clone 4E1
  • RBM14 monoclonal antibody (M01), clone 4E1

RBM14 monoclonal antibody (M01), clone 4E1

Ref: AB-H00010432-M01
RBM14 monoclonal antibody (M01), clone 4E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBM14.
Información adicional
Size 100 ug
Gene Name RBM14
Gene Alias COAA|DKFZp779J0927|MGC15912|MGC31756|PSP2|SIP|SYTIP1|TMEM137
Gene Description RNA binding motif protein 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBM14 (AAH00488, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10432
Clone Number 4E1
Iso type IgG2a Kappa

Enviar un mensaje


RBM14 monoclonal antibody (M01), clone 4E1

RBM14 monoclonal antibody (M01), clone 4E1