ARIH2 purified MaxPab mouse polyclonal antibody (B01P)
  • ARIH2 purified MaxPab mouse polyclonal antibody (B01P)

ARIH2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010425-B01P
ARIH2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARIH2 protein.
Información adicional
Size 50 ug
Gene Name ARIH2
Gene Alias ARI2|FLJ10938|FLJ33921|TRIAD1
Gene Description ariadne homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLVEARVQPNPSKHVPTSHPPHHCAVCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPLLPNEELREKYRRYLFRDYVESHYQLQLCPGADCPMVIRVQEPRARRVQCNRCNEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARIH2 (NP_006312.1, 1 a.a. ~ 493 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10425

Enviar un mensaje


ARIH2 purified MaxPab mouse polyclonal antibody (B01P)

ARIH2 purified MaxPab mouse polyclonal antibody (B01P)