PGRMC2 monoclonal antibody (M03), clone 2A3
  • PGRMC2 monoclonal antibody (M03), clone 2A3

PGRMC2 monoclonal antibody (M03), clone 2A3

Ref: AB-H00010424-M03
PGRMC2 monoclonal antibody (M03), clone 2A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PGRMC2.
Información adicional
Size 100 ug
Gene Name PGRMC2
Gene Alias DG6|PMBP
Gene Description progesterone receptor membrane component 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGRMC2 (NP_006311, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10424
Clone Number 2A3
Iso type IgG1 Kappa

Enviar un mensaje


PGRMC2 monoclonal antibody (M03), clone 2A3

PGRMC2 monoclonal antibody (M03), clone 2A3