PGRMC2 polyclonal antibody (A01)
  • PGRMC2 polyclonal antibody (A01)

PGRMC2 polyclonal antibody (A01)

Ref: AB-H00010424-A01
PGRMC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PGRMC2.
Información adicional
Size 50 uL
Gene Name PGRMC2
Gene Alias DG6|PMBP
Gene Description progesterone receptor membrane component 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGRMC2 (NP_006311, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10424

Enviar un mensaje


PGRMC2 polyclonal antibody (A01)

PGRMC2 polyclonal antibody (A01)