CDIPT monoclonal antibody (M02A), clone 1F8
  • CDIPT monoclonal antibody (M02A), clone 1F8

CDIPT monoclonal antibody (M02A), clone 1F8

Ref: AB-H00010423-M02A
CDIPT monoclonal antibody (M02A), clone 1F8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CDIPT.
Información adicional
Size 200 uL
Gene Name CDIPT
Gene Alias MGC1328|PIS|PIS1
Gene Description CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDIPT (AAH01444, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10423
Clone Number 1F8
Iso type IgM Kappa

Enviar un mensaje


CDIPT monoclonal antibody (M02A), clone 1F8

CDIPT monoclonal antibody (M02A), clone 1F8