TESK2 purified MaxPab mouse polyclonal antibody (B01P)
  • TESK2 purified MaxPab mouse polyclonal antibody (B01P)

TESK2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010420-B01P
TESK2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TESK2 protein.
Información adicional
Size 50 ug
Gene Name TESK2
Gene Alias -
Gene Description testis-specific kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAFSRLTRLDDFTCEKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILRFMGVCVHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSKNCLIKRDENGYSAVVADFGLAEKIPDVSMGSEKLAVVGSPFWMAPEVLRDEPYNEKADVFSYGIILCEIIARIQA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TESK2 (AAH33085.1, 1 a.a. ~ 542 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10420

Enviar un mensaje


TESK2 purified MaxPab mouse polyclonal antibody (B01P)

TESK2 purified MaxPab mouse polyclonal antibody (B01P)