PRMT5 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRMT5 purified MaxPab rabbit polyclonal antibody (D01P)

PRMT5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010419-D01P
PRMT5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRMT5 protein.
Información adicional
Size 100 ug
Gene Name PRMT5
Gene Alias HRMT1L5|IBP72|JBP1|SKB1|SKB1Hs
Gene Description protein arginine methyltransferase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRMT5 (NP_006100.2, 1 a.a. ~ 637 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10419

Enviar un mensaje


PRMT5 purified MaxPab rabbit polyclonal antibody (D01P)

PRMT5 purified MaxPab rabbit polyclonal antibody (D01P)