Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
YAP1 monoclonal antibody (M02), clone 2C2
Abnova
YAP1 monoclonal antibody (M02), clone 2C2
Ref: AB-H00010413-M02
YAP1 monoclonal antibody (M02), clone 2C2
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant YAP1.
Información adicional
Size
100 ug
Gene Name
YAP1
Gene Alias
YAP|YAP2|YAP65|YKI
Gene Description
Yes-associated protein 1, 65kDa
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
10413
Clone Number
2C2
Iso type
IgG2a Kappa
Enviar un mensaje
YAP1 monoclonal antibody (M02), clone 2C2
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*