YAP1 monoclonal antibody (M01A), clone 2F12
  • YAP1 monoclonal antibody (M01A), clone 2F12

YAP1 monoclonal antibody (M01A), clone 2F12

Ref: AB-H00010413-M01A
YAP1 monoclonal antibody (M01A), clone 2F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant YAP1.
Información adicional
Size 200 uL
Gene Name YAP1
Gene Alias YAP|YAP2|YAP65|YKI
Gene Description Yes-associated protein 1, 65kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10413
Clone Number 2F12
Iso type IgG2a Kappa

Enviar un mensaje


YAP1 monoclonal antibody (M01A), clone 2F12

YAP1 monoclonal antibody (M01A), clone 2F12