Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
YAP1 monoclonal antibody (M01A), clone 2F12
Abnova
YAP1 monoclonal antibody (M01A), clone 2F12
Ref: AB-H00010413-M01A
YAP1 monoclonal antibody (M01A), clone 2F12
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant YAP1.
Información adicional
Size
200 uL
Gene Name
YAP1
Gene Alias
YAP|YAP2|YAP65|YKI
Gene Description
Yes-associated protein 1, 65kDa
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In ascites fluid
Gene ID
10413
Clone Number
2F12
Iso type
IgG2a Kappa
Enviar un mensaje
YAP1 monoclonal antibody (M01A), clone 2F12
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*