Ver mas grande
YAP1 monoclonal antibody (M01), clone 2F12
AB-H00010413-M01
Producto nuevo
YAP1 monoclonal antibody (M01), clone 2F12
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | YAP1 |
| Gene Alias | YAP|YAP2|YAP65|YKI |
| Gene Description | Yes-associated protein 1, 65kDa |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,IHC-P,ELISA,IF |
| Immunogen Prot. Seq | QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10413 |
| Clone Number | 2F12 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant YAP1.