RAPGEF3 polyclonal antibody (A01)
  • RAPGEF3 polyclonal antibody (A01)

RAPGEF3 polyclonal antibody (A01)

Ref: AB-H00010411-A01
RAPGEF3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAPGEF3.
Información adicional
Size 50 uL
Gene Name RAPGEF3
Gene Alias CAMP-GEFI|EPAC|EPAC1|HSU79275|MGC21410|bcm910
Gene Description Rap guanine nucleotide exchange factor (GEF) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FMPLLLKDMTFIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAPGEF3 (AAH17728, 772 a.a. ~ 881 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10411

Enviar un mensaje


RAPGEF3 polyclonal antibody (A01)

RAPGEF3 polyclonal antibody (A01)