IFITM3 polyclonal antibody (A01)
  • IFITM3 polyclonal antibody (A01)

IFITM3 polyclonal antibody (A01)

Ref: AB-H00010410-A01
IFITM3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant IFITM3.
Información adicional
Size 50 uL
Gene Name IFITM3
Gene Alias 1-8U|IP15
Gene Description interferon induced transmembrane protein 3 (1-8U)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10410

Enviar un mensaje


IFITM3 polyclonal antibody (A01)

IFITM3 polyclonal antibody (A01)